PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C015239P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 224aa    MW: 25485.6 Da    PI: 10.3206
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C015239P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.21.8e-171150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i n+s r+ t+ kR+ g++KK +ELS+LC++e++ iifs+
  MELO3C015239P1 11 IANDSARKATYKKRKRGLMKKVSELSTLCGIEACAIIFSP 50
                    89*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.283149IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-25160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-25295IPR002100Transcription factor, MADS-box
CDDcd002662.69E-34285No hitNo description
PRINTSPR004043.4E-10323IPR002100Transcription factor, MADS-box
PfamPF003197.0E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MTRKKVKLAY IANDSARKAT YKKRKRGLMK KVSELSTLCG IEACAIIFSP YDSQPELWPS  60
PIGVQRVLSQ FKKMPEMEQS KKMVNQETFL RQRIAKANEQ LKKMRKDNRE KEITRLMFQS  120
LTAAKGLHGL NMLDLNDLGW LIDQNLKDIT IRIDSLKKPS LPQPQAQAQA QAPPTTQPQT  180
AAWLMELVSP QDQMGFVGDD MLLPFGDQTY NHNNAMWSNA FFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIANDSARKATYKKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818060.0LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450513.11e-166PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK31e-65AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A0A0LVS31e-149A0A0A0LVS3_CUCSA; Uncharacterized protein
STRINGVIT_14s0060g00300.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-66AGAMOUS-like 80